Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNPLA2 Peptide - middle region

PNPLA2 Peptide - middle region

Product Specifications

Product Name Alternative

1110001C14Rik, ATGL, DESNUTRIN, DKFZp667M109, FP17548, PEDF-R, TTS-2.2, TTS2

UniProt

Q96AD5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNPLA2 Rabbit Polyclonal Antibody (orb584172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065109

Preservative

Lyophilized powder

AA Sequence

RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCC1 (NM_024523) Human Over-expression Lysate
LS079571-100ug 100 µg

GCC1 (NM_024523) Human Over-expression Lysate

Sign In for Pricing
View Details
PCMV-T7-CPLX1 (rat) -P103A-SV40-Neo
BZ47966 1 Vial

PCMV-T7-CPLX1 (rat) -P103A-SV40-Neo

Sign In for Pricing
View Details
ARCN1 siRNA (Human)
orb1867993-01 15 nmol

ARCN1 siRNA (Human)

Sign In for Pricing
View Details
ARCN1 siRNA (Human)
orb1867993-02 30 nmol

ARCN1 siRNA (Human)

Sign In for Pricing
View Details
Mmu-miR-3074-5p miRNA Agomir
CMN0722-01 5 nmol

Mmu-miR-3074-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-3074-5p miRNA Agomir
CMN0722-02 10 nmol

Mmu-miR-3074-5p miRNA Agomir

Sign In for Pricing
View Details