Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRP Peptide - C-terminal region

GRP Peptide - C-terminal region

Product Specifications

Product Name Alternative

BN, GRP-10, preproGRP, proGRP

UniProt

P07492

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRP Rabbit Polyclonal Antibody (orb584374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012530

Preservative

Lyophilized powder

AA Sequence

ENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKGSQREGRNPQLNQQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scrambled miRNA with GFP Adenovirus (Ad-EF1a-Ctrl-miR-GFP)
1914 200 µL

Scrambled miRNA with GFP Adenovirus (Ad-EF1a-Ctrl-miR-GFP)

Sign In for Pricing
View Details
Rabbit anti-CD1a Antibody
YLD1421-01 50 µL

Rabbit anti-CD1a Antibody

Sign In for Pricing
View Details
Rabbit anti-CD1a Antibody
YLD1421-02 100 µL

Rabbit anti-CD1a Antibody

Sign In for Pricing
View Details
CD68 Antibody
V3175-20UG 20 µg

CD68 Antibody

Sign In for Pricing
View Details
COMMD7 Antibody
MBS153340-01 0.1 mg

COMMD7 Antibody

Sign In for Pricing
View Details
COMMD7 Antibody
MBS153340-02 5x 0.1 mg

COMMD7 Antibody

Sign In for Pricing
View Details