GRP Peptide - C-terminal region
GRP Peptide - C-terminal region
Product Specifications
Product Name Alternative
BN, GRP-10, preproGRP, proGRP
UniProt
P07492
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GRP Rabbit Polyclonal Antibody (orb584374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012530
Preservative
Lyophilized powder
AA Sequence
ENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKGSQREGRNPQLNQQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1072290-01 0.5 mg (E-Coli)
Recombinant Human Protocadherin-8 (PCDH8), partial
Sign In for Pricing
View Details 
MBS1072290-02 0.05 mg (Baculovirus)
Recombinant Human Protocadherin-8 (PCDH8), partial
Sign In for Pricing
View Details MBS1072290-03 0.5 mg (Yeast)
Recombinant Human Protocadherin-8 (PCDH8), partial
Sign In for Pricing
View Details 
MBS1072290-04 0.05 mg (Mammalian-Cell)
Recombinant Human Protocadherin-8 (PCDH8), partial
Sign In for Pricing
View Details MBS1072290-05 1 mg (E-Coli)
Recombinant Human Protocadherin-8 (PCDH8), partial
Sign In for Pricing
View Details MBS1072290-06 0.1 mg (Baculovirus)
Recombinant Human Protocadherin-8 (PCDH8), partial
Sign In for Pricing
View Details