Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5K Peptide - N-terminal region

INPP5K Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPS, SKIP

UniProt

Q9BT40

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5K Rabbit Polyclonal Antibody (orb584916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570122

Preservative

Lyophilized powder

AA Sequence

LVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIINC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG5 (Autophagy Marker) (ATG5/2101), CF405S conjugate, 0.1mg/mL
BNC042101-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LHX2 Mouse Monoclonal Antibody [Clone ID: OTI3D3]
CF810302 100 µg

LHX2 Mouse Monoclonal Antibody [Clone ID: OTI3D3]

Sign In for Pricing
View Details
ISG20L2 Human Gene Knockout Kit (CRISPR)
KN400946 1 Kit

ISG20L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS645014 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Cytochrome P450 2J2 Antibody
8C12269-AAT 50 µg

Cytochrome P450 2J2 Antibody

Sign In for Pricing
View Details
EBF3 (NM_001005463) Human Recombinant Protein
TP315222L 1 mg

EBF3 (NM_001005463) Human Recombinant Protein

Sign In for Pricing
View Details