Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5K Peptide - N-terminal region

INPP5K Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPS, SKIP

UniProt

Q9BT40

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5K Rabbit Polyclonal Antibody (orb584916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570122

Preservative

Lyophilized powder

AA Sequence

LVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIINC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E/Z)-Geranylacetone
TRC-G367778-5G 5 g

(E/Z)-Geranylacetone

Sign In for Pricing
View Details
(3β,4α,5α)-3,4-Dihydroxyandrostan-17-one
TRC-D450108-1MG 1 mg

(3β,4α,5α)-3,4-Dihydroxyandrostan-17-one

Sign In for Pricing
View Details
ZFP161 (ZBTB14) Human Gene Knockout Kit (CRISPR)
KN420750 1 Kit

ZFP161 (ZBTB14) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXN4 Human qPCR Primer Pair (NM_213596)
HP219815 200 Reactions

FOXN4 Human qPCR Primer Pair (NM_213596)

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS701882 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
TRMT1 Polyclonal Antibody
E-AB-52656-01 20 µL

TRMT1 Polyclonal Antibody

Sign In for Pricing
View Details