Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATC Peptide - N-terminal region

GATC Peptide - N-terminal region

Product Specifications

Product Name Alternative

15E1.2, FLJ37000, MGC129938

UniProt

O43716

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GATC Rabbit Polyclonal Antibody (orb326463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789788

Preservative

Lyophilized powder

AA Sequence

GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA2 Rabbit Polyclonal Antibody
orb624391-01 50 µg

ABCA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABCA2 Rabbit Polyclonal Antibody
orb624391-02 100 µg

ABCA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IL18 (Interleukin 18) ELISA Kit
EK240759 96 Well

Human IL18 (Interleukin 18) ELISA Kit

Sign In for Pricing
View Details
5-Formyl-2-methyl-1H-pyrrole-3-carboxylic acid
SSA56359-01 50 mg

5-Formyl-2-methyl-1H-pyrrole-3-carboxylic acid

Sign In for Pricing
View Details
5-Formyl-2-methyl-1H-pyrrole-3-carboxylic acid
SSA56359-02 0.5 g

5-Formyl-2-methyl-1H-pyrrole-3-carboxylic acid

Sign In for Pricing
View Details
3-Bromo-4-chlorobenzhydrazide
sc-283684 1 g

3-Bromo-4-chlorobenzhydrazide

Sign In for Pricing
View Details