Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATC Peptide - N-terminal region

GATC Peptide - N-terminal region

Product Specifications

Product Name Alternative

15E1.2, FLJ37000, MGC129938

UniProt

O43716

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GATC Rabbit Polyclonal Antibody (orb326463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789788

Preservative

Lyophilized powder

AA Sequence

GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1G1 polyclonal antibody
orb1717990-01 50 µL

CSNK1G1 polyclonal antibody

Sign In for Pricing
View Details
CSNK1G1 polyclonal antibody
orb1717990-02 100 µL

CSNK1G1 polyclonal antibody

Sign In for Pricing
View Details
Slc26a11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4751605 3x 1.0 µg

Slc26a11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Muc20 (NM_001107089) Rat Untagged Clone
RN207389 10 µg

Muc20 (NM_001107089) Rat Untagged Clone

Sign In for Pricing
View Details
YB1 Recombinant Rabbit mAb, FITC conjugated
orb3184208 100 µL

YB1 Recombinant Rabbit mAb, FITC conjugated

Sign In for Pricing
View Details
Human anti Protein phosphatase 1A IgG antibody (anti-PPM1A IgG) ELISA Kit
201-12-7057 96 Tests

Human anti Protein phosphatase 1A IgG antibody (anti-PPM1A IgG) ELISA Kit

Sign In for Pricing
View Details