Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1B Peptide - C-terminal region

HSPA1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ54328, HSP70-1B, HSP70-2, HSPA1A

UniProt

P08107

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA1B Rabbit Polyclonal Antibody (orb585795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005337

Preservative

Lyophilized powder

AA Sequence

DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS29P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV784945 1.0 µg DNA

RPS29P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4, MGC21116) (MaxLight 490)
MBS6400202-01 0.1 mL

Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4, MGC21116) (MaxLight 490)

Sign In for Pricing
View Details
Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4, MGC21116) (MaxLight 490)
MBS6400202-02 5x 0.1 mL

Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4, MGC21116) (MaxLight 490)

Sign In for Pricing
View Details
Anti-IFNAR2 Antibody Picoband®, Dylight550 Conjugate
A02056-3-Dylight550 100 µg

Anti-IFNAR2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
ADAMTS19, ID (A Disintegrin And Metalloproteinase With Thrombospondin Motifs 19, ADAMTS-19, ADAM-TS 19, ADAM-TS19) (MaxLight 550)
MBS6461539-01 0.1 mL

ADAMTS19, ID (A Disintegrin And Metalloproteinase With Thrombospondin Motifs 19, ADAMTS-19, ADAM-TS 19, ADAM-TS19) (MaxLight 550)

Sign In for Pricing
View Details
ADAMTS19, ID (A Disintegrin And Metalloproteinase With Thrombospondin Motifs 19, ADAMTS-19, ADAM-TS 19, ADAM-TS19) (MaxLight 550)
MBS6461539-02 5x 0.1 mL

ADAMTS19, ID (A Disintegrin And Metalloproteinase With Thrombospondin Motifs 19, ADAMTS-19, ADAM-TS 19, ADAM-TS19) (MaxLight 550)

Sign In for Pricing
View Details