Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7 Peptide - N-terminal region

COQ7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAT5, CLK-1, CLK1

UniProt

Q99807

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COQ7 Rabbit Polyclonal Antibody (orb585834) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057222

Preservative

Lyophilized powder

AA Sequence

GQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OxiSelect™ HORAC Activity Assay Kit
STA-346 192 Assays

OxiSelect™ HORAC Activity Assay Kit

Sign In for Pricing
View Details
Mouse Monoclonal HLA G Antibody (MEM-G/1) [Alexa Fluor 700]
NB500-302AF700 0.1 mL

Mouse Monoclonal HLA G Antibody (MEM-G/1) [Alexa Fluor 700]

Sign In for Pricing
View Details
CD74 (By2) : m-IgGκ BP-HRP Bundle
sc-533808 1 Kit

CD74 (By2) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Biotinylated Human Siglec-2/CD22 Protein Recombinant
MBS553836-01 0.05 mg

Biotinylated Human Siglec-2/CD22 Protein Recombinant

Sign In for Pricing
View Details
Biotinylated Human Siglec-2/CD22 Protein Recombinant
MBS553836-02 0.25 mg

Biotinylated Human Siglec-2/CD22 Protein Recombinant

Sign In for Pricing
View Details
Biotinylated Human Siglec-2/CD22 Protein Recombinant
MBS553836-03 5x 0.25 mg

Biotinylated Human Siglec-2/CD22 Protein Recombinant

Sign In for Pricing
View Details