Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7 Peptide - N-terminal region

COQ7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAT5, CLK-1, CLK1

UniProt

Q99807

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COQ7 Rabbit Polyclonal Antibody (orb585834) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057222

Preservative

Lyophilized powder

AA Sequence

GQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DOCK9 shRNA Plasmid
abx958198-01 150 µg

Human DOCK9 shRNA Plasmid

Sign In for Pricing
View Details
Human DOCK9 shRNA Plasmid
abx958198-02 300 µg

Human DOCK9 shRNA Plasmid

Sign In for Pricing
View Details
CALD1 ORF Vector (Human) (pORF)
ORF001822 1.0 µg DNA

CALD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Proteasome Subunit Alpha Type 5 (PSMa5)
MBS2077667-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Proteasome Subunit Alpha Type 5 (PSMa5)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Proteasome Subunit Alpha Type 5 (PSMa5)
MBS2077667-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Proteasome Subunit Alpha Type 5 (PSMa5)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Proteasome Subunit Alpha Type 5 (PSMa5)
MBS2077667-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Proteasome Subunit Alpha Type 5 (PSMa5)

Sign In for Pricing
View Details