Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHANK2 Peptide - C-terminal region

SHANK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AUTS17, CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHANK2 Rabbit Polyclonal Antibody (orb585849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW74775

Preservative

Lyophilized powder

AA Sequence

DLVKQKKSDTPQSPSLNSSQPTNSADSKKPASLSNCLPASFLPPPESFDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LRCH1 Antibody [Alexa Fluor 488]
NBP2-44282AF488 0.1 mL

Rabbit Polyclonal LRCH1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit Polyclonal METTL11B Antibody
NBP1-88494 0.1 mL

Rabbit Polyclonal METTL11B Antibody

Sign In for Pricing
View Details
Vorapaxar (SCH 530348) 1mg
A12832-1 1 mg

Vorapaxar (SCH 530348) 1mg

Sign In for Pricing
View Details
ELL (NM_006532) Human Tagged Lenti ORF Clone
RC208258L2 10 µg

ELL (NM_006532) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Mucin 5 Subtype AC (MUC5AC) CLIA Kit
MBS2000928-01 24 Strip Well

Human Mucin 5 Subtype AC (MUC5AC) CLIA Kit

Sign In for Pricing
View Details
Human Mucin 5 Subtype AC (MUC5AC) CLIA Kit
MBS2000928-02 48 Well

Human Mucin 5 Subtype AC (MUC5AC) CLIA Kit

Sign In for Pricing
View Details