Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE11A Peptide - N-terminal region

PDE11A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ23693, MGC133355, MGC133356, PPNAD2

UniProt

Q9HCR9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE11A Rabbit Polyclonal Antibody (orb331261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058649

Preservative

Lyophilized powder

AA Sequence

RRASQKELRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD123 Antibody[6H6]
E-AB-F1117D-01 20 Tests

PE Anti-Human CD123 Antibody[6H6]

Sign In for Pricing
View Details
PE Anti-Human CD123 Antibody[6H6]
E-AB-F1117D-02 100 Tests

PE Anti-Human CD123 Antibody[6H6]

Sign In for Pricing
View Details
PE Anti-Human CD123 Antibody[6H6]
E-AB-F1117D-03 2x 100 Tests

PE Anti-Human CD123 Antibody[6H6]

Sign In for Pricing
View Details
AMACR (NM_014324) Human Over-expression Lysate
LY402314 100 µg

AMACR (NM_014324) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802839 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Rpl39 Mouse Gene Knockout Kit (CRISPR)
KN515048 1 Kit

Rpl39 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details