Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP4 Peptide - C-terminal region

DUSP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HVH2, MKP-2, MKP2, TYP

UniProt

Q13115

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP4 Rabbit Polyclonal Antibody (orb585860) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001385

Preservative

Lyophilized powder

AA Sequence

GQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGV

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISG20 Human Pre-designed siRNA Set A
HY-RS06930 1 Set

ISG20 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit
MBS2503121-01 24 Tests

Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit

Sign In for Pricing
View Details
Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit
MBS2503121-02 48 Tests

Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit

Sign In for Pricing
View Details
Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit
MBS2503121-03 96 Tests

Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit

Sign In for Pricing
View Details
Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit
MBS2503121-04 5x 96 Tests

Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit

Sign In for Pricing
View Details
Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit
MBS2503121-05 10x 96 Tests

Monkey PKCzeta (Protein Kinase C Zeta) ELISA Kit

Sign In for Pricing
View Details