Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84 Peptide - C-terminal region

CD84 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp781E2378, LY9B, SLAMF5, hCD84, mCD84

UniProt

Q9UIB8

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD84 Rabbit Polyclonal Antibody (orb585864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171811

Preservative

Lyophilized powder

AA Sequence

LLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal 200kDa Neurofilament Heavy Antibody (9B12)
TA336710 100 µL

Mouse Monoclonal 200kDa Neurofilament Heavy Antibody (9B12)

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody (RBITC)
orb2364246 100 µL

GFAP Mouse Monoclonal Antibody (RBITC)

Sign In for Pricing
View Details
Shh Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1544R-BF680-01 20 µL

Shh Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Shh Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1544R-BF680-02 100 µL

Shh Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
1- (2-Methylbenzyl) piperazine
FM112278-01 1000 mg

1- (2-Methylbenzyl) piperazine

Sign In for Pricing
View Details
1- (2-Methylbenzyl) piperazine
FM112278-02 2000 mg

1- (2-Methylbenzyl) piperazine

Sign In for Pricing
View Details