Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84 Peptide - C-terminal region

CD84 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp781E2378, LY9B, SLAMF5, hCD84, mCD84

UniProt

Q9UIB8

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD84 Rabbit Polyclonal Antibody (orb585864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171811

Preservative

Lyophilized powder

AA Sequence

LLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eph receptor A7 (EPHA7) (NM_004440) Human Over-expression Lysate
E45H01325-2 20 µg

Eph receptor A7 (EPHA7) (NM_004440) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain (free and bound) Mouse Monoclonal Antibody [Clone ID: NI 412, NI 268]
AM20245BT-N 200 µg

Human Lambda Light Chain (free and bound) Mouse Monoclonal Antibody [Clone ID: NI 412, NI 268]

Sign In for Pricing
View Details
M6A (N6-methyladenosine)
S3190-50mg 50 mg

M6A (N6-methyladenosine)

Sign In for Pricing
View Details
Sheep Osteopontin ELISA kit
GTR10441996 96 Well

Sheep Osteopontin ELISA kit

Sign In for Pricing
View Details
Rno-miR-450b-3p miRNA Inhibitor
orb1868266-01 10 nmol

Rno-miR-450b-3p miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-450b-3p miRNA Inhibitor
orb1868266-02 20 nmol

Rno-miR-450b-3p miRNA Inhibitor

Sign In for Pricing
View Details