Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCO1 Peptide - C-terminal region

BCO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BCO, BCDO, BCMO, BCDO1, BCMO1

UniProt

Q9HAY6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCO1 Rabbit Polyclonal Antibody (orb585872) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_059125

Preservative

Lyophilized powder

AA Sequence

AKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLKL (Ser345) Recombinant Rabbit mAb, PE-Cy7 conjugated
orb2349657 100 µL

MLKL (Ser345) Recombinant Rabbit mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Vps16 3'UTR Luciferase Stable Cell Line
TU122120 1.0 mL

Vps16 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Fx1A Polyclonal Antibody
TMAB-06219-01 50 μL

Anti-Fx1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Fx1A Polyclonal Antibody
TMAB-06219-02 100 µL

Anti-Fx1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Fx1A Polyclonal Antibody
TMAB-06219-03 200 µL

Anti-Fx1A Polyclonal Antibody

Sign In for Pricing
View Details
Vortioxetine D8
T13308 1 mg

Vortioxetine D8

Sign In for Pricing
View Details