Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RILP Peptide - C-terminal region

RILP Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ31193, PP10141

UniProt

Q96NA2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RILP Rabbit Polyclonal Antibody (orb585881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113618

Preservative

Lyophilized powder

AA Sequence

FGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S156 Recombinant Protein (Human)
RP087120 100 µg

RN5S156 Recombinant Protein (Human)

Sign In for Pricing
View Details
Human IGFBP-2 (Insulin-like Growth Factor Binding Protein 2) ValidElisa Kit
EK341598 96 Well

Human IGFBP-2 (Insulin-like Growth Factor Binding Protein 2) ValidElisa Kit

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
MBS8571325-01 0.1 mL

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
MBS8571325-02 0.1 mL (AF405L)

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
MBS8571325-03 0.1 mL (AF405S)

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
MBS8571325-04 0.1 mL (AF610)

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details