Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RILP Peptide - C-terminal region

RILP Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ31193, PP10141

UniProt

Q96NA2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RILP Rabbit Polyclonal Antibody (orb585881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113618

Preservative

Lyophilized powder

AA Sequence

FGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTN4RL1 Antibody - C-terminal region : FITC (ARP67787_P050-FITC)
ARP67787_P050-FITC 100 µL

RTN4RL1 Antibody - C-terminal region : FITC (ARP67787_P050-FITC)

Sign In for Pricing
View Details
Toll Interacting Protein 1 Human Recombinant
rAP-4298 1 Each

Toll Interacting Protein 1 Human Recombinant

Sign In for Pricing
View Details
MS4A8B, NT (MS4A8B, 4SPAN4, Membrane-spanning 4-domains subfamily A member 8B, Four-span transmembrane protein 4) (AP)
MBS6322450-01 0.2 mL

MS4A8B, NT (MS4A8B, 4SPAN4, Membrane-spanning 4-domains subfamily A member 8B, Four-span transmembrane protein 4) (AP)

Sign In for Pricing
View Details
MS4A8B, NT (MS4A8B, 4SPAN4, Membrane-spanning 4-domains subfamily A member 8B, Four-span transmembrane protein 4) (AP)
MBS6322450-02 5x 0.2 mL

MS4A8B, NT (MS4A8B, 4SPAN4, Membrane-spanning 4-domains subfamily A member 8B, Four-span transmembrane protein 4) (AP)

Sign In for Pricing
View Details
N-Heptan für die Rückstandsanalyse
LC-2720.2 2.5 L

N-Heptan für die Rückstandsanalyse

Sign In for Pricing
View Details
Vom2r28 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV651522 1.0 µg DNA

Vom2r28 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details