Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCSH Peptide - C-terminal region

GCSH Peptide - C-terminal region

Product Specifications

Product Name Alternative

GCE, NKH

UniProt

P23434

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCSH Rabbit Polyclonal Antibody (orb585896) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004474

Preservative

Lyophilized powder

AA Sequence

NEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf144 (SZRD1) (N-term) Rabbit Polyclonal Antibody
AP50534PU-N 400 µL

C1orf144 (SZRD1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VCX3B Human Gene Knockout Kit (CRISPR)
KN418667 1 Kit

VCX3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF621 activation kit by CRISPRa
GA117207 1 Kit

Human ZNF621 activation kit by CRISPRa

Sign In for Pricing
View Details
Dgat2 Mouse Gene Knockout Kit (CRISPR)
KN304521 1 Kit

Dgat2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF594 conjugate, 0.1mg/mL
BNC942312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxyphosphamide Benzyl Ester-d4
TRC-C181357-5MG 5 mg

Carboxyphosphamide Benzyl Ester-d4

Sign In for Pricing
View Details