Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSAD Peptide - C-terminal region

CSAD Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSD, FLJ44987, FLJ45500, MGC119354, MGC119355, MGC119357, PCAP

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSAD Rabbit Polyclonal Antibody (orb585917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001231635

Preservative

Lyophilized powder

AA Sequence

PPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamate Decarboxylase 2 (GAD2) Antibody
abx141572-01 50 µL

Glutamate Decarboxylase 2 (GAD2) Antibody

Sign In for Pricing
View Details
Glutamate Decarboxylase 2 (GAD2) Antibody
abx141572-02 100 µL

Glutamate Decarboxylase 2 (GAD2) Antibody

Sign In for Pricing
View Details
Glutamate Decarboxylase 2 (GAD2) Antibody
abx141572-03 200 µL

Glutamate Decarboxylase 2 (GAD2) Antibody

Sign In for Pricing
View Details
Cbz-L-Valinol
OR452148-01 250 mg

Cbz-L-Valinol

Sign In for Pricing
View Details
Cbz-L-Valinol
OR452148-02 25 g

Cbz-L-Valinol

Sign In for Pricing
View Details
NR0B2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV694881 1.0 µg DNA

NR0B2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details