CSAD Peptide - C-terminal region
CSAD Peptide - C-terminal region
Product Specifications
Product Name Alternative
CSD, FLJ44987, FLJ45500, MGC119354, MGC119355, MGC119357, PCAP
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CSAD Rabbit Polyclonal Antibody (orb585917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001231635
Preservative
Lyophilized powder
AA Sequence
PPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRV
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx692050 100 µg
Human Family with Sequence Similarity 20, Member C (FAM20C) Protein
Sign In for Pricing
View Details 