Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPP1 Peptide - N-terminal region

MPP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AAG12, DXS552E, EMP55, MRG1, PEMP

UniProt

B4DZV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPP1 Rabbit Polyclonal Antibody (orb585920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159934

Preservative

Lyophilized powder

AA Sequence

APGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Laminin PicoKine® Quick ELISA Kit
FEK0434 96 Well With Removable Strips

Human Laminin PicoKine® Quick ELISA Kit

Sign In for Pricing
View Details
PRODH2 CytoSection
TS415144P5 25 Slides

PRODH2 CytoSection

Sign In for Pricing
View Details
Goat cytochrome c oxidase subunit VIa polypeptide 1 (COX6A1) ELISA kit
GTR10397485 96 Well

Goat cytochrome c oxidase subunit VIa polypeptide 1 (COX6A1) ELISA kit

Sign In for Pricing
View Details
Anti-Human TIGIT Recombinant Antibody (Etigilimab)
YR1499-01 1 mg

Anti-Human TIGIT Recombinant Antibody (Etigilimab)

Sign In for Pricing
View Details
Anti-Human TIGIT Recombinant Antibody (Etigilimab)
YR1499-02 5 mg

Anti-Human TIGIT Recombinant Antibody (Etigilimab)

Sign In for Pricing
View Details
96 x 0.2 ml Transformer NetFlex Plate
B58701 25 Plates/Box

96 x 0.2 ml Transformer NetFlex Plate

Sign In for Pricing
View Details