Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL2 Peptide - N-terminal region

NEIL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31644, MGC2832, MGC4505, NEH2, NEI2

UniProt

Q969S2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEIL2 Rabbit Polyclonal Antibody (orb585921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129219

Preservative

Lyophilized powder

AA Sequence

GDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTK Recombinant Protein
OPCD07748-50UG 50 µg

TTK Recombinant Protein

Sign In for Pricing
View Details
Rabbit Anti-Bovine Gelsolin (GSN) Polyclonal Antibody
VD11N406 1 Each

Rabbit Anti-Bovine Gelsolin (GSN) Polyclonal Antibody

Sign In for Pricing
View Details
VASH2 Antibody
MBS7052961-01 0.05 mg

VASH2 Antibody

Sign In for Pricing
View Details
VASH2 Antibody
MBS7052961-02 0.1 mg

VASH2 Antibody

Sign In for Pricing
View Details
VASH2 Antibody
MBS7052961-03 5x 0.1 mg

VASH2 Antibody

Sign In for Pricing
View Details
Anti-HSD17B3 Antibody Picoband®, FITC Conjugate
A04128-3-FITC 100 µg/Vial

Anti-HSD17B3 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details