Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL2 Peptide - N-terminal region

NEIL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31644, MGC2832, MGC4505, NEH2, NEI2

UniProt

Q969S2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEIL2 Rabbit Polyclonal Antibody (orb585921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129219

Preservative

Lyophilized powder

AA Sequence

GDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human METTL1 Protein, N-His
MBS1576931-01 0.1 mg

Recombinant Human METTL1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human METTL1 Protein, N-His
MBS1576931-02 1 mg

Recombinant Human METTL1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human METTL1 Protein, N-His
MBS1576931-03 5x 1 mg

Recombinant Human METTL1 Protein, N-His

Sign In for Pricing
View Details
SCY1 like 3 (SCYL3) (NM_020423) Human Over-expression Lysate
LS057147 100 µg

SCY1 like 3 (SCYL3) (NM_020423) Human Over-expression Lysate

Sign In for Pricing
View Details
ABHD11 (NM_148912) Human 3' UTR Clone
SC206232 10 µg

ABHD11 (NM_148912) Human 3' UTR Clone

Sign In for Pricing
View Details
BAG5 Antibody (N-term)
orb164063-01 50 µL

BAG5 Antibody (N-term)

Sign In for Pricing
View Details