Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFC1 Peptide - N-terminal region

CFC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CRYPTIC, FLJ77897, HTX2, MGC133213, CFC1B, DTGA2

UniProt

P0CG37

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFC1 Rabbit Polyclonal Antibody (orb585929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115934

Preservative

Lyophilized powder

AA Sequence

IINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H3 (acetyl K56) Antibody
RC-15321-01 50 μL

Recombinant Histone H3 (acetyl K56) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (acetyl K56) Antibody
RC-15321-02 100 µL

Recombinant Histone H3 (acetyl K56) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (acetyl K56) Antibody
RC-15321-03 1 mL

Recombinant Histone H3 (acetyl K56) Antibody

Sign In for Pricing
View Details
l-Myc (MYCL) (NM_001033082) Human Over-expression Lysate
LY422362 100 µg

l-Myc (MYCL) (NM_001033082) Human Over-expression Lysate

Sign In for Pricing
View Details
SAP18 (Center) Rabbit Polyclonal Antibody
AP53795PU-N 400 µL

SAP18 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 Antibody
KC-1934-01 50 μL

CD63 Antibody

Sign In for Pricing
View Details