CFC1 Peptide - N-terminal region
CFC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CRYPTIC, FLJ77897, HTX2, MGC133213, CFC1B, DTGA2
UniProt
P0CG37
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFC1 Rabbit Polyclonal Antibody (orb585929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115934
Preservative
Lyophilized powder
AA Sequence
IINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM041281-01 10 µg
Recombinant Mouse REN1/Renin-1 Protein (His Tag)
Sign In for Pricing
View Details PKSM041281-02 50 µg
Recombinant Mouse REN1/Renin-1 Protein (His Tag)
Sign In for Pricing
View Details 
BNUB2347-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), 0.2mg/mL
Sign In for Pricing
View Details 