Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14A Peptide - C-terminal region

CDC14A Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdc14, hCDC14

UniProt

Q9UNH5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC14A Rabbit Polyclonal Antibody (orb585938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003663

Preservative

Lyophilized powder

AA Sequence

DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC11A2 siRNA (Human)
MBS8231272-01 15 nmol

SLC11A2 siRNA (Human)

Sign In for Pricing
View Details
SLC11A2 siRNA (Human)
MBS8231272-02 30 nmol

SLC11A2 siRNA (Human)

Sign In for Pricing
View Details
SLC11A2 siRNA (Human)
MBS8231272-03 5x 30 nmol

SLC11A2 siRNA (Human)

Sign In for Pricing
View Details
Interleukin-18-binding Polyclonal Antibody
MBS9415663-01 0.1 mg

Interleukin-18-binding Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin-18-binding Polyclonal Antibody
MBS9415663-02 5x 0.1 mg

Interleukin-18-binding Polyclonal Antibody

Sign In for Pricing
View Details
pExpress-1-Atf6b Plasmid
PVT39419 2 µg

pExpress-1-Atf6b Plasmid

Sign In for Pricing
View Details