Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14A Peptide - C-terminal region

CDC14A Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdc14, hCDC14

UniProt

Q9UNH5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC14A Rabbit Polyclonal Antibody (orb585938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003663

Preservative

Lyophilized powder

AA Sequence

DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKIV2L2 Rabbit pAb (APR25927N)
APR25927N-01 50 µL

SKIV2L2 Rabbit pAb (APR25927N)

Sign In for Pricing
View Details
SKIV2L2 Rabbit pAb (APR25927N)
APR25927N-02 100 µL

SKIV2L2 Rabbit pAb (APR25927N)

Sign In for Pricing
View Details
SKIV2L2 Rabbit pAb (APR25927N)
APR25927N-03 200 µL

SKIV2L2 Rabbit pAb (APR25927N)

Sign In for Pricing
View Details
CD33 (B-9) Alexa Fluor® 790
sc-374450 AF790 200 µg/mL

CD33 (B-9) Alexa Fluor® 790

Sign In for Pricing
View Details
4930432K09Rik Lentiviral Activation Particles (m)
sc-428644-LAC 200 µL

4930432K09Rik Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Survivin, human recombinant
4160-10 10 µg

Survivin, human recombinant

Sign In for Pricing
View Details