Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPSA Peptide - middle region

NAPSA Peptide - middle region

Product Specifications

Product Name Alternative

KAP, Kdap, NAP1, NAPA, SNAPA

UniProt

O96009

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAPSA Rabbit Polyclonal Antibody (orb585994) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004842

Preservative

Lyophilized powder

AA Sequence

SVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit
MBS2709077-01 24 Strip Well

Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit

Sign In for Pricing
View Details
Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit
MBS2709077-02 48 Well

Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit

Sign In for Pricing
View Details
Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit
MBS2709077-03 96 Well

Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit

Sign In for Pricing
View Details
Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit
MBS2709077-04 5x 96 Well

Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit

Sign In for Pricing
View Details
Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit
MBS2709077-05 10x 96 Well

Mouse Left/Right Determination Factor 1 (LEFTY1) CLIA Kit

Sign In for Pricing
View Details
SULT1A2 siRNA (Human)
orb1863607-01 15 nmol

SULT1A2 siRNA (Human)

Sign In for Pricing
View Details