Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX2 Peptide - C-terminal region

SNX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC5204, TRG-9

UniProt

O60749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX2 Rabbit Polyclonal Antibody (orb585997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003091

Preservative

Lyophilized powder

AA Sequence

EWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TWIST2 (Twist-related Protein 2, Class A Basic Helix-loop-helix Protein 39, bHLHa39, Dermis-expressed Protein 1, DERMO1, Dermo-1, FFDD, SETLSS) (MaxLight 490)
MBS6397672-01 0.1 mL

TWIST2 (Twist-related Protein 2, Class A Basic Helix-loop-helix Protein 39, bHLHa39, Dermis-expressed Protein 1, DERMO1, Dermo-1, FFDD, SETLSS) (MaxLight 490)

Sign In for Pricing
View Details
TWIST2 (Twist-related Protein 2, Class A Basic Helix-loop-helix Protein 39, bHLHa39, Dermis-expressed Protein 1, DERMO1, Dermo-1, FFDD, SETLSS) (MaxLight 490)
MBS6397672-02 5x 0.1 mL

TWIST2 (Twist-related Protein 2, Class A Basic Helix-loop-helix Protein 39, bHLHa39, Dermis-expressed Protein 1, DERMO1, Dermo-1, FFDD, SETLSS) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Klotho (Klotho) ELISA Kit
YP-W72037-01 48 Tests

Rabbit Klotho (Klotho) ELISA Kit

Sign In for Pricing
View Details
Rabbit Klotho (Klotho) ELISA Kit
YP-W72037-02 96 Tests

Rabbit Klotho (Klotho) ELISA Kit

Sign In for Pricing
View Details
ANTKMT (NM_023933) Human 3' UTR Clone
SC200001 10 µg

ANTKMT (NM_023933) Human 3' UTR Clone

Sign In for Pricing
View Details
IL1b (BSB-139)
MBS370472-01 5 Slides

IL1b (BSB-139)

Sign In for Pricing
View Details