Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX2 Peptide - C-terminal region

SNX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC5204, TRG-9

UniProt

O60749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX2 Rabbit Polyclonal Antibody (orb585997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003091

Preservative

Lyophilized powder

AA Sequence

EWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMEM Glucose Free Without L-Glutamine And Sodium Pyruvate  500ml
IDMEM0273500ML 500 mL

DMEM Glucose Free Without L-Glutamine And Sodium Pyruvate 500ml

Sign In for Pricing
View Details
Sheep Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit
YP-W79081-01 48 Tests

Sheep Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit

Sign In for Pricing
View Details
Sheep Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit
YP-W79081-02 96 Tests

Sheep Heat Shock 70kDa Protein 2 (HSPA2) ELISA Kit

Sign In for Pricing
View Details
DPF3 CRISPR Activation Plasmid (m)
sc-427628-ACT 20 µg

DPF3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
TNFSF15 Recombinant Protein
OPCD07909-200UG 200 µg

TNFSF15 Recombinant Protein

Sign In for Pricing
View Details
SCYE1 (Small Inducible Cytokine Subfamily E, Member 1 (Endothelial monocyte-Activating), AIMP1, EMAP2, EMAPII, p43) (FITC)
MBS6175052-01 0.1 mL

SCYE1 (Small Inducible Cytokine Subfamily E, Member 1 (Endothelial monocyte-Activating), AIMP1, EMAP2, EMAPII, p43) (FITC)

Sign In for Pricing
View Details