Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL6 Peptide - C-terminal region

ELOVL6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FACE, FAE, FLJ23378, LCE, MGC5487

UniProt

Q9H5J4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELOVL6 Rabbit Polyclonal Antibody (orb586001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076995

Preservative

Lyophilized powder

AA Sequence

VFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) ELISA Kit
EK20661 48 Tests

Rat SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) ELISA Kit

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 405) discontinued
247048-ML405 100 µL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Olr473 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV634856 1.0 µg DNA

Olr473 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Human IFNA16 Protein
E30P1589 20 µg

Recombinant Human IFNA16 Protein

Sign In for Pricing
View Details
EZH1 Peptide - N-terminal region
MBS3228862-01 0.1 mg

EZH1 Peptide - N-terminal region

Sign In for Pricing
View Details
EZH1 Peptide - N-terminal region
MBS3228862-02 5x 0.1 mg

EZH1 Peptide - N-terminal region

Sign In for Pricing
View Details