Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL6 Peptide - C-terminal region

ELOVL6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FACE, FAE, FLJ23378, LCE, MGC5487

UniProt

Q9H5J4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELOVL6 Rabbit Polyclonal Antibody (orb586001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076995

Preservative

Lyophilized powder

AA Sequence

VFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H1C (Ab-25) Antibody
A77800-100UL 100 µL

HIST1H1C (Ab-25) Antibody

Sign In for Pricing
View Details
MRPS17 Rabbit pAb, PE-Cy7 conjugated
orb2889161 100 µL

MRPS17 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Mouse IL-22 ELISA Kit
SEKM-0023-01 48 Tests

Mouse IL-22 ELISA Kit

Sign In for Pricing
View Details
Mouse IL-22 ELISA Kit
SEKM-0023-02 96 Tests

Mouse IL-22 ELISA Kit

Sign In for Pricing
View Details
CA VB (N280) polyclonal antibody
BS3098 50ul

CA VB (N280) polyclonal antibody

Sign In for Pricing
View Details
ANKS1A Knockout HGC-27 Polyclonal Cells
ARG29533 1 Million

ANKS1A Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details