Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL6 Peptide - C-terminal region

ELOVL6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FACE, FAE, FLJ23378, LCE, MGC5487

UniProt

Q9H5J4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELOVL6 Rabbit Polyclonal Antibody (orb586001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076995

Preservative

Lyophilized powder

AA Sequence

VFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 Monoclonal Antibody
ABM40202-01 30 µL

HSP27 Monoclonal Antibody

Sign In for Pricing
View Details
HSP27 Monoclonal Antibody
ABM40202-02 100 µL

HSP27 Monoclonal Antibody

Sign In for Pricing
View Details
HSP27 Monoclonal Antibody
ABM40202-03 200 µL

HSP27 Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-mouse Scavenger receptor cysteine-rich type 1 protein M130 polyclonal Antibody, Biotin conjugated
MBS1488581-01 0.05 mg

Rabbit anti-mouse Scavenger receptor cysteine-rich type 1 protein M130 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Scavenger receptor cysteine-rich type 1 protein M130 polyclonal Antibody, Biotin conjugated
MBS1488581-02 0.1 mg

Rabbit anti-mouse Scavenger receptor cysteine-rich type 1 protein M130 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Scavenger receptor cysteine-rich type 1 protein M130 polyclonal Antibody, Biotin conjugated
MBS1488581-03 5x 0.1 mg

Rabbit anti-mouse Scavenger receptor cysteine-rich type 1 protein M130 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details