HTRA3 Peptide - middle region
HTRA3 Peptide - middle region
Product Specifications
Product Name Alternative
Prsp, Tasp
UniProt
P83110
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HTRA3 Rabbit Polyclonal Antibody (orb586003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_444272
Preservative
Lyophilized powder
AA Sequence
TNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6445239-01 0.1 mL
BHLHE40 (Class E Basic Helix-loop-helix Protein 40, Basic Helix-loop-helix Family Member e40, DEC1, HLHB2, BHLHB2, STRA13, Stra14, SHARP-2) (APC)
Sign In for Pricing
View Details MBS6445239-02 5x 0.1 mL
BHLHE40 (Class E Basic Helix-loop-helix Protein 40, Basic Helix-loop-helix Family Member e40, DEC1, HLHB2, BHLHB2, STRA13, Stra14, SHARP-2) (APC)
Sign In for Pricing
View Details