Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA3 Peptide - middle region

HTRA3 Peptide - middle region

Product Specifications

Product Name Alternative

Prsp, Tasp

UniProt

P83110

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HTRA3 Rabbit Polyclonal Antibody (orb586003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444272

Preservative

Lyophilized powder

AA Sequence

TNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Npvf ELISA Kit
ELI-18083r 96 Tests

Rat Npvf ELISA Kit

Sign In for Pricing
View Details
Adenosine Microplate Assay Kit
MBS8327495-01 100 Assays

Adenosine Microplate Assay Kit

Sign In for Pricing
View Details
Adenosine Microplate Assay Kit
MBS8327495-02 5x 100 Assays

Adenosine Microplate Assay Kit

Sign In for Pricing
View Details
OR5D16 Antibody
MBS9606656-01 0.1 mL

OR5D16 Antibody

Sign In for Pricing
View Details
OR5D16 Antibody
MBS9606656-02 0.2 mL

OR5D16 Antibody

Sign In for Pricing
View Details
OR5D16 Antibody
MBS9606656-03 5x 0.2 mL

OR5D16 Antibody

Sign In for Pricing
View Details