Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX16 Peptide - C-terminal region

STX16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC90328, SYN16, hsyn16

UniProt

O14662

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX16 Rabbit Polyclonal Antibody (orb586007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003754

Preservative

Lyophilized powder

AA Sequence

AMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10AD1 Antibody
8G416-AAT 50 µg

OR10AD1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2D6 Monoclonal Antibody
E-AB-81500-01 50 µL

Recombinant Cytochrome P450 2D6 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2D6 Monoclonal Antibody
E-AB-81500-02 100 µL

Recombinant Cytochrome P450 2D6 Monoclonal Antibody

Sign In for Pricing
View Details
CST6 (NM_001323) Human Over-expression Lysate
LY400530 100 µg

CST6 (NM_001323) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Relaxin 1 (RLN1) activation kit by CRISPRa
GA104105 1 Kit

Human Relaxin 1 (RLN1) activation kit by CRISPRa

Sign In for Pricing
View Details
LIMK2 Recombinant Rabbit monoclonal Antibody
HA751247 100 µL

LIMK2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details