Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX16 Peptide - C-terminal region

STX16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC90328, SYN16, hsyn16

UniProt

O14662

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX16 Rabbit Polyclonal Antibody (orb586007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003754

Preservative

Lyophilized powder

AA Sequence

AMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Over-expression Lysate
LY402188 100 µg

Mortality Factor 4 like 2 (MORF4L2) (NM_012286) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Bromocinnamic acid
TRC-B685013-2.5G 2.5 g

3-Bromocinnamic acid

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560491 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Daidzein Diacetate
TRC-D103495-500MG 500 mg

Daidzein Diacetate

Sign In for Pricing
View Details
1-O-Levulinoyl Resveratrol Diacetate
TRC-L379700-10MG 10 mg

1-O-Levulinoyl Resveratrol Diacetate

Sign In for Pricing
View Details
Paralemmin (PALM) (NM_002579) Human Over-expression Lysate
LY419238 100 µg

Paralemmin (PALM) (NM_002579) Human Over-expression Lysate

Sign In for Pricing
View Details