Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1 Peptide - middle region

HRH1 Peptide - middle region

Product Specifications

Product Name Alternative

H1-R, hisH1

UniProt

P35367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HRH1 Rabbit Polyclonal Antibody (orb331289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000852

Preservative

Lyophilized powder

AA Sequence

ENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELT (NM_001029887) Human Recombinant Protein
TP315012M 100 µg

HELT (NM_001029887) Human Recombinant Protein

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF405S conjugate, 0.1mg/mL
BNC040296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Interleukin 11 (IL11) ELISA Kit
RDR-IL11-Mu-01 96 Tests

Mouse Interleukin 11 (IL11) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 11 (IL11) ELISA Kit
RDR-IL11-Mu-02 48 Tests

Mouse Interleukin 11 (IL11) ELISA Kit

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-01 50 μL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-02 100 µL

RNF31 Antibody

Sign In for Pricing
View Details