Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1 Peptide - middle region

HRH1 Peptide - middle region

Product Specifications

Product Name Alternative

H1-R, hisH1

UniProt

P35367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HRH1 Rabbit Polyclonal Antibody (orb331289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000852

Preservative

Lyophilized powder

AA Sequence

ENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3b,5a,6a,20R)-Pregnane-3,6,20-triol
TRC-P030990-25MG 25 mg

(3b,5a,6a,20R)-Pregnane-3,6,20-triol

Sign In for Pricing
View Details
Horizontal head, for 4 x 15ml
BV1000-H150 1 Each

Horizontal head, for 4 x 15ml

Sign In for Pricing
View Details
Recombinant KDM4A Monoclonal Antibody
E-AB-81576-01 50 µL

Recombinant KDM4A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant KDM4A Monoclonal Antibody
E-AB-81576-02 100 µL

Recombinant KDM4A Monoclonal Antibody

Sign In for Pricing
View Details
GAcrp30 Human, His
OM296808-01 10 µg

GAcrp30 Human, His

Sign In for Pricing
View Details
GAcrp30 Human, His
OM296808-02 2 µg

GAcrp30 Human, His

Sign In for Pricing
View Details