Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP25 Peptide - middle region

MMP25 Peptide - middle region

Product Specifications

Product Name Alternative

MMP20, MMP20A, MMPL1, MT-MMP6, MT6-MMP

UniProt

Q9NPA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP25 Rabbit Polyclonal Antibody (orb586019) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071913

Preservative

Lyophilized powder

AA Sequence

FGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPZB (N-term) Rabbit Polyclonal Antibody
AP17178PU-N 400 µL

CAPZB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF568 conjugate, 0.1mg/mL
BNC682444-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562874 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF647 conjugate, 0.1mg/mL
BNC471832-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Luciferin, sodium salt *CAS#: 103404-75-7*
12509-AAT 25 mg

D-Luciferin, sodium salt *CAS#: 103404-75-7*

Sign In for Pricing
View Details
HLA Class 1 ABC Mouse Monoclonal Antibody [11C2]
EM1801-10 100 µL

HLA Class 1 ABC Mouse Monoclonal Antibody [11C2]

Sign In for Pricing
View Details