Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE8B Peptide - middle region

PDE8B Peptide - middle region

Product Specifications

Product Name Alternative

ADSD, FLJ11212, PPNAD3

UniProt

O95263

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE8B Rabbit Polyclonal Antibody (orb586021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025022

Preservative

Lyophilized powder

AA Sequence

TELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yars 3'UTR Luciferase Stable Cell Line
TU122412 1.0 mL

Yars 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
General Glutathione (GSH) ELISA Kit
EK20188 48 Tests

General Glutathione (GSH) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Enterobacteria phage T4 (Bacteriophage T4) SEGC Polyclonal Antibody
MBS7153657 Inquire

Rabbit anti-Enterobacteria phage T4 (Bacteriophage T4) SEGC Polyclonal Antibody

Sign In for Pricing
View Details
Human Beta-1,3-N-acetylglucosaminyltransferase radical fringe, RFNG ELISA KIT
E2100Hu-01 48 Well

Human Beta-1,3-N-acetylglucosaminyltransferase radical fringe, RFNG ELISA KIT

Sign In for Pricing
View Details
Human Beta-1,3-N-acetylglucosaminyltransferase radical fringe, RFNG ELISA KIT
E2100Hu-02 96 Well

Human Beta-1,3-N-acetylglucosaminyltransferase radical fringe, RFNG ELISA KIT

Sign In for Pricing
View Details
Human Beta-1,3-N-acetylglucosaminyltransferase radical fringe, RFNG ELISA KIT
E2100Hu-03 5x 96 Tests

Human Beta-1,3-N-acetylglucosaminyltransferase radical fringe, RFNG ELISA KIT

Sign In for Pricing
View Details