Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD2 Peptide - N-terminal region

AMPD2 Peptide - N-terminal region

Product Specifications

UniProt

Q01433

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMPD2 Rabbit Polyclonal Antibody (orb586025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631895

Preservative

Lyophilized powder

AA Sequence

FLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EPHA2 (Ser901) Peptide
AF7284-BP 1 mg

Phospho-EPHA2 (Ser901) Peptide

Sign In for Pricing
View Details
RNF152 Protein Vector (Human) (pPB-C-His)
PV118174 500 ng

RNF152 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Brn-3a CRISPR Activation Plasmid (h2)
sc-400322-ACT-2 20 µg

Brn-3a CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Rabbit Monoclonal PTH Antibody (PTH/1717R) [Alexa Fluor 405]
NBP2-54474AF405 100 µL

Rabbit Monoclonal PTH Antibody (PTH/1717R) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse Monoclonal Stathmin 1 Antibody (STMN1/8438) [FITC]
NBP3-26962F 0.1 mL

Mouse Monoclonal Stathmin 1 Antibody (STMN1/8438) [FITC]

Sign In for Pricing
View Details
CYB5R4 (NM_016230) Human Over-expression Lysate
LC402521 20 µg

CYB5R4 (NM_016230) Human Over-expression Lysate

Sign In for Pricing
View Details