Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD2 Peptide - N-terminal region

AMPD2 Peptide - N-terminal region

Product Specifications

UniProt

Q01433

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMPD2 Rabbit Polyclonal Antibody (orb586025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631895

Preservative

Lyophilized powder

AA Sequence

FLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC117 siRNA (Human)
CRJ5648-01 15 nmol

CCDC117 siRNA (Human)

Sign In for Pricing
View Details
CCDC117 siRNA (Human)
CRJ5648-02 30 nmol

CCDC117 siRNA (Human)

Sign In for Pricing
View Details
Olfr1205 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4284107 1.0 µg DNA

Olfr1205 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
HGPR61 full length protein-synthetic nanodisc
orb2707803-01 10 µg

HGPR61 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HGPR61 full length protein-synthetic nanodisc
orb2707803-02 50 µg

HGPR61 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
UBE2G1 CRISPRa sgRNA lentivector (set of three targets)(Human)
48971121 3x 1.0µg DNA

UBE2G1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details