Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED7 Peptide - C-terminal region

MED7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRSP33, CRSP9, MGC12284, ARC34

UniProt

O43513

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED7 Rabbit Polyclonal Antibody (orb576684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_004261

Preservative

Lyophilized powder

AA Sequence

LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLT8D1 antibody
orb618833 100 µL

GLT8D1 antibody

Sign In for Pricing
View Details
Human CCDC138 shRNA Plasmid
abx966020-01 150 µg

Human CCDC138 shRNA Plasmid

Sign In for Pricing
View Details
Human CCDC138 shRNA Plasmid
abx966020-02 300 µg

Human CCDC138 shRNA Plasmid

Sign In for Pricing
View Details
Porcine Calicin (CCIN) ELISA Kit
GTR10369481 96 Well

Porcine Calicin (CCIN) ELISA Kit

Sign In for Pricing
View Details
Glutathione Reductase Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-21564R-PerCP-Cy5.5 100 µL

Glutathione Reductase Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
KRT8P23 ORF Vector (Human) (pORF)
26072011 1.0 µg DNA

KRT8P23 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details