Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALLC Peptide - N-terminal region

ALLC Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALC

UniProt

B4DY77

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALLC Rabbit Polyclonal Antibody (orb326172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060906

Preservative

Lyophilized powder

AA Sequence

ERGTRTGAAATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus cereus Trigger factor (tig)
MBS1324575-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Trigger factor (tig)
MBS1324575-02 0.02 mg (Yeast)

Recombinant Bacillus cereus Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Trigger factor (tig)
MBS1324575-03 0.1 mg (E-Coli)

Recombinant Bacillus cereus Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Trigger factor (tig)
MBS1324575-04 0.1 mg (Yeast)

Recombinant Bacillus cereus Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Trigger factor (tig)
MBS1324575-05 0.02 mg (Baculovirus)

Recombinant Bacillus cereus Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Trigger factor (tig)
MBS1324575-06 0.02 mg (Mammalian-Cell)

Recombinant Bacillus cereus Trigger factor (tig)

Sign In for Pricing
View Details