LRRFIP2 Peptide - C-terminal region
LRRFIP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp434H2035, FLJ20248, FLJ22683, FLJ58304, HUFI-2
UniProt
Q9Y608
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRFIP2 Rabbit Polyclonal Antibody (orb584199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006300
Preservative
Lyophilized powder
AA Sequence
RKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP11835PU-N 400 µL
Zfp219 (ZNF219) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
GAF-004-40 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgD, 40nm
Sign In for Pricing
View Details 
BNUM2250-50 1x 50 µL
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), 1mg/mL
Sign In for Pricing
View Details 
BNC050661-100 1x 100 µL
P24-HIV (p24/661), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-H952210-50MG 50 mg
21-Hydroxypregna-1,4,16-triene-3,11,20-trione (>85%)
Sign In for Pricing
View Details