Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRFIP2 Peptide - C-terminal region

LRRFIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434H2035, FLJ20248, FLJ22683, FLJ58304, HUFI-2

UniProt

Q9Y608

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRFIP2 Rabbit Polyclonal Antibody (orb584199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006300

Preservative

Lyophilized powder

AA Sequence

RKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 Recombinant Rabbit monoclonal Antibody
HA750151 100 µL

CD31 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse FGF-9/FGF9 Protein (His Tag)
PKSM041022-01 10 µg

Recombinant Mouse FGF-9/FGF9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse FGF-9/FGF9 Protein (His Tag)
PKSM041022-02 50 µg

Recombinant Mouse FGF-9/FGF9 Protein (His Tag)

Sign In for Pricing
View Details
TIA1 Human Gene Knockout Kit (CRISPR)
KN415053 1 Kit

TIA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lsm2 (BC049543) Mouse Tagged ORF Clone
MG200745 10 µg

Lsm2 (BC049543) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ABAT Mouse Monoclonal Antibody [Clone ID: OTI7H1]
CF806969 100 µg

ABAT Mouse Monoclonal Antibody [Clone ID: OTI7H1]

Sign In for Pricing
View Details