Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RWDD3 Peptide - middle region

RWDD3 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp566K023, RSUME

UniProt

Q9Y3V2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RWDD3 Rabbit Polyclonal Antibody (orb584315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056300

Preservative

Lyophilized powder

AA Sequence

ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCART6 (SLC25A53) Human Gene Knockout Kit (CRISPR)
KN422214 1 Kit

MCART6 (SLC25A53) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Procyclidine Hydrochloride
TRC-P755840-50MG 50 mg

Procyclidine Hydrochloride

Sign In for Pricing
View Details
EGR1 Human Gene Knockout Kit (CRISPR)
KN209956LP 1 Kit

EGR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IDO1 (NM_002164) Human Over-expression Lysate
LC400784 20 µg

IDO1 (NM_002164) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR560117 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Slc38a3 Mouse Gene Knockout Kit (CRISPR)
KN516093 1 Kit

Slc38a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details