Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA12 Peptide - N-terminal region

MAGEA12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT1.12, MAGE12

UniProt

P43365

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA12 Rabbit Polyclonal Antibody (orb584494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005358

Preservative

Lyophilized powder

AA Sequence

STLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB1 (Cyclic AMP-responsive Element-binding Protein 1, CREB-1, cAMP-responsive Element-binding Protein 1) (HRP)
125311-HRP 100 µL

CREB1 (Cyclic AMP-responsive Element-binding Protein 1, CREB-1, cAMP-responsive Element-binding Protein 1) (HRP)

Sign In for Pricing
View Details
Akirin2 Antibody
4805-002mg 0.02 mg

Akirin2 Antibody

Sign In for Pricing
View Details
FG-DN100PN64-PFTE Flange Guards
311608 1 Pack (1 Piece (s) x 1 Pack)

FG-DN100PN64-PFTE Flange Guards

Sign In for Pricing
View Details
Gm16390 Protein Vector (Mouse) (pPM-C-HA)
21921024 500 ng

Gm16390 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
genesig Real-time PCR detection kit for ASFV
Z-Path-ASFV 150 Tests

genesig Real-time PCR detection kit for ASFV

Sign In for Pricing
View Details
FAM149B1 (NM_173348) Human Over-expression Lysate
LS317662-100ug 100 µg

FAM149B1 (NM_173348) Human Over-expression Lysate

Sign In for Pricing
View Details