Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA12 Peptide - N-terminal region

MAGEA12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT1.12, MAGE12

UniProt

P43365

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA12 Rabbit Polyclonal Antibody (orb584494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005358

Preservative

Lyophilized powder

AA Sequence

STLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYCN Antibody (FITC)
orb25862-01 50 µg

SYCN Antibody (FITC)

Sign In for Pricing
View Details
SYCN Antibody (FITC)
orb25862-02 100 µg

SYCN Antibody (FITC)

Sign In for Pricing
View Details
Bovine Fibroblast Growth Factor 4 (FGF4) ELSIA Kit
EIA05654Bo 1 Kit

Bovine Fibroblast Growth Factor 4 (FGF4) ELSIA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS628439 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Dectin 2 (Dendritic Cell-associated C-type Lectin 2, DC-associated C-type Lectin 2, Dectin-2, C-type Lectin Domain Family 6 Member A, CLEC6A, C-type Lectin Superfamily Member 10, CLECSF10) (MaxLight 490)
MBS6253817-01 0.1 mL

Dectin 2 (Dendritic Cell-associated C-type Lectin 2, DC-associated C-type Lectin 2, Dectin-2, C-type Lectin Domain Family 6 Member A, CLEC6A, C-type Lectin Superfamily Member 10, CLECSF10) (MaxLight 490)

Sign In for Pricing
View Details
Dectin 2 (Dendritic Cell-associated C-type Lectin 2, DC-associated C-type Lectin 2, Dectin-2, C-type Lectin Domain Family 6 Member A, CLEC6A, C-type Lectin Superfamily Member 10, CLECSF10) (MaxLight 490)
MBS6253817-02 5x 0.1 mL

Dectin 2 (Dendritic Cell-associated C-type Lectin 2, DC-associated C-type Lectin 2, Dectin-2, C-type Lectin Domain Family 6 Member A, CLEC6A, C-type Lectin Superfamily Member 10, CLECSF10) (MaxLight 490)

Sign In for Pricing
View Details